PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013472-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 260aa    MW: 30056.9 Da    PI: 7.0003
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013472-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.84.2e-091962302155
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            + +yp+++++++L++ +gL+ +q+ +WF N+R ++
  SMil_00013472-RA_Salv 196 RWPYPTEDDKKRLSETTGLDHKQINNWFINQRKRH 230
                            569*****************************885 PP

2ELK25.82.4e-09150169120
                    ELK   1 ELKhqLlrKYsgyLgsLkqE 20 
                            ELK++ +rKYsgy +sL++E
  SMil_00013472-RA_Salv 150 ELKEMVMRKYSGYVSSLRKE 169
                            9******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.7E-182670IPR005540KNOX1
PfamPF037903.1E-192867IPR005540KNOX1
SMARTSM012566.8E-1873124IPR005541KNOX2
PfamPF037911.3E-1976123IPR005541KNOX2
PROSITE profilePS512139.778150170IPR005539ELK domain
SMARTSM011881.3E-4150171IPR005539ELK domain
PfamPF037891.1E-5150169IPR005539ELK domain
PROSITE profilePS5007112.957170233IPR001356Homeobox domain
SMARTSM003893.8E-12172237IPR001356Homeobox domain
SuperFamilySSF466891.33E-18172241IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-26175235IPR009057Homeodomain-like
CDDcd000865.50E-12182234No hitNo description
PfamPF059201.4E-16190229IPR008422Homeobox KN domain
PROSITE patternPS000270208231IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MDEHLYASIS PFHYSSFDSD ESEEQDLIKA RIANHPLYPA LLSSYIDCTK VGAPPEMASL  60
LDQISKQDHP IFIATQIGTD PELDYFMRSY CDALRKYKEE LSKPMDEARS FLSSIGSQLT  120
HLCKQTLPSS TTSHHSTDEE MRCGEEVGVE LKEMVMRKYS GYVSSLRKEM AKKRKKGKLP  180
KDAISALFQW WNTHYRWPYP TEDDKKRLSE TTGLDHKQIN NWFINQRKRH WRPSHDMRFA  240
LIQGVAPHAD AHASFNDAIL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165174LRKEMAKKRK
2170176AKKRKKG
3171175KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087493.11e-110PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP296e-86KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0E3TKF51e-107A0A0E3TKF5_9ERIC; Knotted-like 6 protein
STRINGVIT_14s0060g01180.t017e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.12e-70KNOTTED-like from Arabidopsis thaliana 2